Hendrickson walking beam suspension bushing replacement. Starting at $66. Table 1: 45745-225, Rev G, AR2 Air Walking Beam Suspension Brochure Author: Hendrickson Truck Commercial Vehicle Systems- AF Subject: 45745-225, Rev G, AR2 Air Walking Beam Suspension Brochure Created Date: 7/13/2023 10:59:48 AM Beam End Bushing. Walking beam suspension showing top plate, bolts, and saddle assembly. Each hollow rubber spring is mounted between a frame-rail plate and the centre (front-to-rear) of the steel walking beam. 26. Quick Links. 17-18 ™34013-111L 40K reworked, substitute or replacement parts not authorized by hendrickson may not meet hendrickson’s specifications and can result in failure of the part, adverse vehicle handling, possible personal injury or property damage, and will void applicable warranties. Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. A sawhorse bracket assembly is attached to the frame and Order Hendrickson suspension parts for the lift axles, truck and trailer suspensions. Because the patented design allows the tool to be mounted to the suspension piece, the weight of the tool does not need to be held in place during operation. G. Contact Hendrickson for availability of beam lengths. Bar pin beam end connections extend service life and allow axle alignment capability for increased tire life. Opens in a new window or tab. 17730-070 RT/RTE Steel Leaf Spring Suspension Tech Procedure Rev. for Proper Identification or Use 345-610 & 345-661: 34: replacement parts: steerable suspension systems st and prior lit no: h731 date: februar revision: h pst20 us / us2 ur2t13 beam part number -1 for inboard-mounted lift bags re: model number (pre-fix) 3 bushing & pivot bolt kit 1997 - 1997 ut13 ut13 1 r-009560 1997 Bushing Replacement pRoceduRe Tri‑FunCTional® BuSHinG replaCemenT ToolS noTe: The bushing replacement tool is not required for replacing the bushing assembly on an HT Y-beam suspension. Hendrickson Walking Beam Suspension Bushings - The Best Picture Of Beam. ATRO Solutions: ATRO 2-piece torque rod bushings. Insist on only Hendrickson Genuine TRI-FUNCTIONAL Bushes for exact fit and optimum performance. Same day shipping available on most parts. HA 180/200/230, HA 360/400/460 - Single/Tandem Axle Air Suspensions ; COMFORT AIR - Single Axle T Series Walking Beam Suspensions; V4 340/380 Tandem Suspensions; Hendrickson r520 suspension bushingHendrickson walking beam suspension bushing replacement tool Hendrickson suspension bushing replacement on semi trailerHendrickson beam end bushing kit, hendrickson suspension kits www. Uses a premium grade rubber compound 8. Narrow-bushing, tapered-beam air suspension / axle / brake system . hendrickson-intl. Bar pin bushing kit 34013-188L for Hendrickson. Refer to L533 HALFTRAAX™ Axle and Beam Removal/Replacement Procedure for complete HALFTRAAX replacement To learn more about Hendrickson Genuine Parts call 1. x 4. Hendrickson walking beams alignment I believe the single bolt through the ends of the walking beam have a little cam type setup that you rotate to move the axle fore and aft at each corner to adjust the Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. This Hendrickson Center Beam Bushing Kit Replaces Both Sides, This Is An Original Genuine Hendrickson Greaseable Center Bushing Kit, Hendrickson Models (R340K) Series, ORIGINAL GENUINE HENDRICKSON PRODUCT, (COMPARE OUR SHIPPING COSTS). Lightweight for Line-haul, rugged durability for on- and off-highway applications. 1) "Easy Install" replacement bushings. 4261 Hendrickson Front Suspension Bushing Tool • Suspension bushing tool kit used to remove and replace the leaf spring bushings on Hendrickson Airtek NXT front suspensions found on Freightliner Cascadia vehicles. 4246 from: otc, boschBushing hendrickson beam kit Hendrickson Walking Beam Suspension Bushing Replacement Tool - The Best. PRT . L54 - Bushing Replacement ProcedureT Series Split-Ring Beam-End Models Only Rev. Today, Hendrickson has further advanced the “state-of-the-art” with additional weight and cost reductions, while taking another step forward in increasing strength and spring life. EB50-21013 : Bar Pin Bushing Kit | ATRO The Hendrickson Replacement Walking Beam Bushing for OEM 6969 is a practical and environmentally friendly solution for your vehicle's suspension system. Suspension Kit. 0 inch bolt holes. Available for wide and narrow pivot connections, Hendrickson also supplies bushing tools, which are used to properly remove and/or compress Pivot bushings into our suspension's trailing arm assemblies. H Date 12/17 17730-234, Rev B, PARASTEER Technical Procedure - Hendrickson Shop high-quality Hendrickson torque rods and bushings at Big Rig Chrome Shop. Size 0. Installed weight includes complete suspension, torque rods, axle and frame brackets and all hardware. Repair Machine; Hendrickson walking beam suspension bushing replacement tool. New (Other) Hendrickson Walking Beam Suspension Leaf Spring 12 Leaf Super Heavy Duty Version. Technical literature available at www. Details / Buy. RT/RTE Suspension Maintenance AR2™ Air Over Walking Beam Suspension. USE ONLY HENDRICKSON AUTHORIZED REPLACEMENT PARTS. North America; Walking Beam Bulletin - Bronze Center Bushings Rev. Hendrickson-designed springs provide a consistent spring rate for longer life as the equalizing beams distribute load equally between both axles for improved traction. Order now! Hendrickson Replacement Walking Beam Bushing For OEM 6969. The bar pin end bushing also allows up to 3/8 inches axle alignment at the beam end for improved tire life. Used to install Hendrickson S-24691 Tri-Functional bushing kit. End beam bushing kit#hendrickson suspension bushings replacement Hendrickson suspension bushingsAmazon. This brand is known for its expertise in producing air suspension systems and components such as beam end bushings, bolster springs, bushings, center bushings, and other mechanical, elastomeric, and integrated For additional details regarding specifications, applications, capacities, operating, service and maintenance instructions, refer to applicable Hendrickson technical literature or contact Hendrickson at 630-910-2800; 1. • Rubber springs provide long service life and easy replacement • Bar pin end bushing extends service life and • Hendrickson torque rod bushings provide longer service life than conventional bushings • Hendrickson parts and service available at thousands of locations body weight. Hendrickson Walking Beam Suspension Bushings - The Best Picture Of Beam Check Details Hendrickson Suspension Bushing - Frontier Truck Parts Check Details Hendrickson Hendrickson Rear Suspension Walking Beam Bushing Replacement YouTube How To Check Hendrickson Suspension Bushings • hendrickson suspension information, (refer to l977. The truck has rte 460 suspension which is 46000 rears and mine has the little tail This all-new rear suspension bushing tool for Heavy Duty vehicles makes Pivot and D-pin bushing removal and installation easier tasks. TWO PIECE TORQUE RODS ULTRA ROD Two Piece Torque Rods — eliminate the need to carry a vast array of one piece torque rod inventoryjust measure, cut and weld. 910. Problem Areas: Rubber load springs and torque rod bushings. 85. The amount Equalizing Beam Bushing Removal 23-25 Rubber End 24-25 Steel Ball & Bronze Socket End 25 Use only genuine Hendrickson replacement parts for servicing these Hendrickson Suspension to determine if a later copy is available. $1,164. Conversion kit center bushing — if existing RT/RTE suspension includes bronze center bushings, The Hendrickson AR2 gives you a better ride and improved suspension performance by converting your RT/RTE suspension into a walking beam air suspension; 8. Energy Suspension UTV Powersports bushings and mounts. Hendrickson Bushing Kit S-24691 | ILoca Services, Inc. Capacity of slider suspension system including slider box, suspensions and axles. $1,415. Hendrickson RTE Walking Beam Hendrickson HAS Air suspension. Quality S-21307 wide beam trailer bushing installation tool for Hendrickson Wide Beam Bushings replaces Hendrickson S-21307. 50"), (1" x 10 1/2") Grade 8 Bolt With Lock Nut And Washers, This Hendrickson Kit Has Solid Adapter Caps, (Caps Are Not Recessed), Internal Reducer Sleeve Over All Length, (3. My Account : Login. Need Help? Contact Us; Hendrickson: T Series Walking Beam Suspension ; Crosses with: Hendrickson 30240-2, BWP HE9G, Automann MHS46, Dayton 322-13, Euclid E-1552 RT/RTE 340 Walking Beam Suspension. Related. 92. SOLD1997 Western Star 4964FX double frame tri-axle dump truck, 3406C Cat Power, 8LL, 46K rears on Chalmers, lots of lights, Sirius radio 2001 F-250 7. The hydraulic Walking beam trailer suspension now replacement chalmers suspension parts technical procedure 17730 070 rev h rt rte rear suspension 17730 070 rev h rt Center bushing service set hendrickson suspension hendrickson suspension parts moog k100027 hendrickson walking beam shim kit suspension parts. Check Details. High Confinement Center Bushing is integral to the performance of many Hendrickson walking beam suspensions. Bar pin end connection — Rugged axle connection extends bushing life and allows easy axle alignment capability for accurate wheel tracking, improved tire life and serviceability. 558) 17-1/16" x 20-11/16" Main Leaf Length Includes Bushing (1-3/8" I. 66086 Tri‑FunCTional® BuSHinG replaCemenT ToolS noTe: The bushing replacement tool is not required for replacing the bushing assembly on an HT Y-beam suspension. Hendrickson Suspension Bushing - Frontier Truck Parts 17730-244 3 Product Description HAULMAAX® Rear Suspension Hendrickson torque rods — Improve cornering by controlling lateral forces . No. Design enhancements to improve weight, comfort, and durability, have left the basic format unchanged. ATRO Intraax/Vantraax Bushing Replacement We offer two options for parts. The service procedures recommended by Hendrickson and described in I know drive axle walking beam suspension Isn't popular anymore. The center rubber grommets seem fine but the metal bushing in the center is egged out what caused this? also there is a pipe that goes from one side to the other that has some wear on it where it slides into the center of the metal bushing what is the purpose Bronze Center Bushing Replaces Hendrickson 30240-2-Bronze Center Bushing Replaces Hendrickson 30240-23-1/2 ID x 4-1/4 OD x 5-7/8 L Applications:Hen. It features bar pin end bushings but there are no center bushings for the beams to pivot on. replacing hendrickson wide bushing suspension bushings on spread axle trailer. Hendrickson walking beam suspension bushing replacement toolNew hendrickson front and rear suspension bushing adapter kits Hendrickson bushing bushings freightHendrickson suspension bushing replacement on semi trailer. I replaced both spring packs this past weeknd on my 96 357 peterbilt dump truck. ,2 Worn into the weld 3 Worn into the weld 3 1. TRANSVERSE TORQUE ROD RESTRICTIONS NOTE Transverse torque rods ARE NOT allowed to be used in conjunction with bronze center bushings. The AR2™ delivers a better ride, longer life, and lighter weight for more payload capacity, improved durability for less downtime, high articulation capabilities for on/off road applications and designed and manufactured components that deliver more comfort and even better system performance. 3 PSD crew cab 4X4 Lariet, DP Tuner ECM, sonnax/tri springs, 3" lift, 305/70R16' HTS 190/210 (Autocar & Spartan) Single Axle Spring Suspension. Bronze center bushings The Hendrickson AR2 gives you a better ride and improved suspension performance by converting your RT/RTE suspension into a walking beam air suspension; The air spring Trying to compress 8 hours of hard work into a 38 minute video. Hendrickson offers a couple variations of the walking beam suspension. Hendrickson — HN; Type: Walking beam suspension with bar pin end bushings. Capacity refers to suspension and axle ratings. The Chalmers 800 Series Rear Suspension is a walking beam-type tandem axle suspension that uses hollow rubber springs instead of leaf springs or air bags. Hendrickson suspension bushing. With a unique design that provides increased stability, improved ride and comfort, and reduced maintenance, AIRTEK is the industry’s first front air suspension and steer axle system. Heavy-duty shocks incorporate rebound spring which limits rapid shock extension during Bushing Torque Rod Suits 48411-006 HAS400 Section 8 Component Replacement maintenance, service, repair and rebuild of the RT™ • RTE™ walking beam rear suspension 46,000 to 70,000 pound capacity suspensions with rubber center bushings, refer to Hendrickson publication 59310-004 and 59310-058 for more information . 3733. Live Chat: 8am - 7pm EST Or call us at (877) 795-0656. REPLACEMENT KITS: Pivot bush replacement kits are listed in the suspension parts For additional details regarding specifications, applications, capacities, operating, service and maintenance instructions, refer to applicable Hendrickson technical literature or contact Hendrickson at 630-910-2800; 1. Choose only Hendrickson Genuine Parts to protect your investment and to ensure optimum performance. Pivot Bushing Replacement Tool Parts List Rev. Hendrickson replacement bushingsCenter and end bushing tool set for hendrickson series Hendrickson walking beam suspension bushings. Please check out https://semiworkin. Hendrickson Walking Beam Suspension Bushings - The Best Picture Of Beam Section 8 Component Replacement maintenance, service, repair and rebuild of the RT™ • RTE™ walking beam rear suspension 46,000 to 70,000 pound capacity suspensions with rubber center bushings, refer to Hendrickson publication 59310-004 and 59310-058 for more information . 755. Keep in mind that a Hendrickson loose axle may be fitted to another manufacturer’s suspension, on the other hand, an HT suspension may be fitted with any type of loose axle. Testing and Validation Capabilities In 1926, Hendrickson introduced our first walking-beam suspension, a concept that is AIRTEK ® Integrated front air suspension and fabricated steer axle system Save up to 97 pounds with AIRTEK. Reviews There are no reviews yet. Select a Region. 4. 05 MB. Next . Brand New. Refer to L533 HALFTRAAX™ Axle and Beam Removal/Replacement Procedure for complete HALFTRAAX replacement The Hendrickson Replacement Walking Beam Bushing for OEM 6969 is a practical and environmentally friendly solution for your vehicle's suspension system. Pivot Bushing. SKU 34013-188L. Be the first to review “Energy Suspenion 90. Kit bushing beam hendrickson endOtc hendrickson bushing Hendrickson bushing kit s-24691Center and end bushing tool Buy Hendrickson 45900 End Beam Bushing, Old Style | 45900 online. 1 (800) Axle & Suspension / Hendrickson / Home / Hendrickson / Aftermarket Replacement for Hendrickson D25364 Beam Bushing TF III Hendrickson/Turner. At Harry J. 743. $16. The Hendrickson HN walking beam suspension features a bar pin end The bushings in the beam where split and starting to move around, so the best way to fix that is to repalce the bushings and weld up a small crack that is st 1. Leave Buy Hendrickson R-009560 Pivot Bushing Kit | R009560 online. Otc introduces new hendrickson front suspension bushing tool set forHendrickson walking beam suspension bushings Otc tools and equipmentHendrickson releases new trailer Hendrickson walking beam suspension bushings Hendrickson bushing kit s-24691 Bushing hendrickson beam kit end truckspring Hendrickson beam suspensiones viga truckpartsandservice Fix Workshop Find out Repair Engine Bronze Center Beam Bushing Kit for 2 beams repalces Hendrickson 30437-000L. Crosses with: BWP HE9G-KIT, AUTOMANN HBK100, DAYTON 322-102, EUCLID E-1546, HENDRICKSON 30437-000L, MERITOR R301546, SIRCO SH2116. Hendrickson RT. Hendrickson Walking Beam Suspensions The Hendrickson walking beam suspension has been an industry standard for heavy-duty vocational trucks for over 70 years or just a little bit longer than Plaza has been in business. OEM: 498417 ATRO: EB34000 Automann: M1976 Gaff: 13501. Buy Hendrickson 07500-594 Walking Beam AXLES AND SUSPENSION; BEARINGS, BUSHINGS AND PINS; BIBS, BOOTS AND WIPERS; CAB; CHUTES; CONTROLS; DECALS AND PLACARDS; DRUM PARTS; ELECTRICAL; FENDERS/ BUMPERS; Aftermarket Replacement for Hendrickson 07500-594 Walking Beam - Fabricated About Press Copyright Contact us Creators Advertise Developers Terms Privacy Policy & Safety How YouTube works Test new features NFL Sunday Ticket Press Copyright Hendrickson suspension bushing replacement on semi trailer Hendrickson suspension bushing Hendrickson bushing beam Iron hendrickson suspension bushing kit at best price in sonipat. Heavy-duty shocks incorporate rebound spring which limits rapid shock extension during Bushing Torque Rod Suits 48411-006 HAS400 This leaf spring fits the following make/models: 1974 to 2019 Heavy Duty Trucks with Hendrickson Walking Beam w/ Leaf Spring Suspensions using 1-3/8" pins Specifications: 4" wide 12 leaves (12/. QTY Trailer SuSpenSion SySTemS axle/Beam WeldmenT SuBJeCT: Replacement Procedures liT no: L533 Axle/BeAm Weldment ReplAcement pRoceduRes imporTanT SaFeTy noTiCeS Bushing tube spacer installation 2. Hendrickson suspension bushing Hendrickson walking beam suspension bushings Suspension hendrickson replacement bushings. 5968 or visit www. Date 04/16. For this suspension type, begin with PIVOT BUSHING INSPECTION on page 5 for pivot connection disassembly and HT™ SERIES Y-BEAM Hendrickson suspension lift axle suspension kits oem# r007474 in dorrAmazon. 50"), Over All Bushing Length (5. 2 Torque Rod Bushing Replacement; 3 Walking Beam Inspection; 4 Walking Beam Repair/Replacement; 5 Axle Alignment; Download this manual; 800 SERIES HEAVY Beam hendrickson walking bushing suspension bushingsHendrickson walking beam suspension bushing replacement tool Hendrickson suspension bushing replacement on semi trailerHendrickson otc. Each Hendrickson center bushing is engineered for specific types of Hendrickson walking beam suspension capacities, Proper service and repair is important to the safe and reliable operation of the tandem suspension. Products. 27. com SP-168 3 For all (*) see Notes on Page 8 EICE KE . noTe: The bushing replacement tool is not required for replacing the bushing assembly on an HT Y-beam suspension. Details. The transverse rod is critical, especially in high center of gravity . • Includes an OTC 4106A 25-ton single acting cylinder. Created Date: 4/13/2018 1:34:35 PM HT ™ Series Reliable, affordable and flexible trailer y-beam air suspension With hundreds of thousands of HT SERIES suspensions on trailers running on- and off-road around the world, these models have been the suspensions of choice for virtually every trailer application for nearly a decade. Refer to L533 HALFTRAAX™ Axle and Beam Removal/Replacement Procedure for complete HALFTRAAX replacement Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. 50"), 3/4" x 6" Grade 8 Bolt With Lock Nut And Washers, This Is An Original Genuine Hendrickson Product Walking Beam Bushing Adapter Kit, This Is Not An After Market Bushing Kit. Web hendrickson suspension available (all that apply): Web 1 the above checks should be done any time suspension is damaged or otherwise not functioning improperly. ATRO, LLC 6 Bolte Lane St. 45745-225, Rev G, AR2 Air Walking Beam Suspension Brochure Author: Hendrickson Truck Commercial Vehicle Systems- AF Subject: 45745-225, Rev G, AR2 Air Walking Beam Suspension Brochure Created Date: 7/13/2023 10:59:48 AM Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. com: HENDRICKSON Bushing KIT INTRAXX Quik-Align (S-24691. Features: Problem Areas: No center bushings for the beams to pivot on. com or contact Hendrickson at 855. 94. Hendrickson Suspension Parts Are Original Replacement Suspension Parts for Hendrickson Trucks. All Products. Three are Beam End Adapter connections and require that the fasteners be kept tight to maintain the clamp of the rubber bushing inner 2 intraax® aant230 trailer suspension parts list index 97114-112 rev h table of contents introduction 3 abbreviations 3 axle and suspension identification 4 axle id plate 4 manufacturing plant identifier 4 date of manufacture 4 manufacturing sequence number 4 suspension assembly number plate 5 assembly number 5 ride height label 5 axle Walking beam-style tandem axle rear suspension: Features: Uses two large elastomeric load springs and eight large torque rods, 4 upper and 4 lower. specific bushings and suspension components. for shock absorbers. 866. comHendrickson suspension rear walking beam removal, rebush, Atro’s KT50-25004 Hendrickson HN Suspension Rebuild Kit is designed for Hendrickson’s walking beam suspension that features bar-pin end bushing. HT affordable and flexible trailer y-beam air suspension . Ensure superior suspension performance by choosing Hendrickson Genuine parts. This provides greater stability and roll stiffness as well as keeping the axle centered laterally and controlling axle walkout on walking beam suspensions. for (2) Beam Ends: 1: 339 Transverse Rods - Provide lateral support for Hendrickson suspensions by transmitting loads directly into the frame, instead of through the suspension. Hendrickson Truck Suspension Parts; RT-RTE 380-400-440-460, RT2-RTE2 400-460 - Tandem Suspensions; Bushing, Beam End; Rubber; 5 3/4"Lg: 4: 29878-1: 460 Series: 26: 334-109: Adapter Kit, Solid Adapters: 4: Hendrickson P/N Stamped on Rod; Provide No. 75"), Inside Diameter Hole (2. Hendrickson suspension lift axle suspension kits oem# r007474 in dorrOtc introduces new hendrickson front suspension bushing tool set for Hendrickson walking beam suspension bushingsSuspension hendrickson replacement bushings. 26. 800 Series pdf manual download. Hendrickson reserves the right to make changes and improvements to its products and publications at any time . Available in top-mount and underslung configurations to fit your application requirements, Hendrickson beam assemblies are made using high-quality steel and our sophisticated manufacturing processes ensure optimal structural integrity. • Fewer bushings to maintain — center bushing eliminated • Rubber springs provide long service life and easy replacement • Bar pin end bushings help extend service life and provide alignment capability for longer tire life • Hendrickson torque rod bushings offer longer service life than conventional bushings noTe: The bushing replacement tool is not required for replacing the bushing assembly on an HT Y-beam suspension. 3001G Categories: Commercial, HENDRICKSON. EICE KE . Hendrickson Suspension Rebuild Kit 2 CB38011 and 4 EB50-21013. But for those people needing to re-bush one, I have a quick and dirty method to remove the From Hendrickson Beam Bushings and Tandem Bolts to Hendrickson Walking Beams, Hendrickson Walking Beam Bushing Kits, Hendrickson Torque Rod Bushings And Thanks For Watching!!! Please Like And Subscribe. com Hendrickson suspension rear walking beam removal, rebush, and reinstall. Please check out https://semiworkin. use only hendrickson-authorized replacement parts. The void design and material composition of our bushings are critical to controlling the horizontal, vertical and roll forces a trailer generates rolling To learn more about Hendrickson Genuine Parts call 1. Replace the HALFTRAAX™ or the beam assembly. applications. Bushing, Beam Center Rubber; Loose Plug: 321-118: 22282: Bushing, Beam Center Rubber; Loose Plug: 321 Home Heb1 Hendrickson Suspension Walking Beam End Ball And Socket Bushing Kit Bronze. 45900. suspension beams, while the Hendrickson HT suspension uses U-bolts and is welded to the axle. Size Trying to compress 8 hours of hard work into a 38 minute video. Whether it’s a walking beam re-bushing or a total walking beam replacement, our service is impeccable. AR2 series pdf manual download 40K • 46K ™ BAR pIN ENd BuSHINg FIguRE 6‑9 An indication that the bar pin end bushing requires replacement is when one or more of the following A shop press with a capacity of at least 100 tons Center bushing tool — (Hendrickson Part No . Buy Hendrickson D25364 Beam Bushing TF III Hendrickson/Turner | D25364 online. Suspension ride heights must be set within Hendrickson specifications in order to ensure proper suspension performance. Hendrickson suspension bushing replacement on semi trailer Otc tools and equipment Hendrickson r520 suspension bushing. Solid bushing without voids; Outer diameter significantly smaller than OE rubber bushings (nearly 1" smaller O. 625) 17-1/16" x 20-11/16" Main Leaf Length Includes Bushing (1-3/8" I. The If HT Y-beam suspension (both welded collar and QUIK-ALIGN® style pivot connections), the entire bushing assembly gets replaced, without the need for a replacement tool. The masking tape (Figure 6) may remain on the bushing tube spacers during installation. Proper alignment of the Tri-Functional bushing is a critical Stripped hex head s bolts removal suspension rubber bushing k replacement chalmers suspension parts l427 trailer suspension Hendrickson walking beam bushings suspension intraax wide beam bushing installation tool hendrickson s 21307 hendrickson haulmaax atro ered systems inc field manual l427 trailer Hendrickson Truck RT/RTE 380/400/440/460, RT2/RT2E 400/460 TANDEM suspension. Tandem Truck Suspensions 65,000 – 100,000 LB. This part cross references with Tri-Functional Bushing Replacement Tool Replaces Hendrickson S-21307. Narrow-bushing, tapered-beam air suspension / Hendrickson AR2 Suspension AR2™ delivers a better ride, Hendrickson AR2 gives you a better ride and improved suspension performance by converting your RT/RTE suspension into a walking beam air suspension. C. Air Over Walking Beam Truck Suspension. Hendrickson designs and manufactures air suspension systems and components for heavy duty Compliant Tie-Rod Assembly (includes stabilizers, flat bar and ends with bushings) 3 years: 1 year: King Pins 1: 1 year: 1 year: 1. For this suspension type, begin with PIVOT BUSHING INSPECTION on page 5 for pivot connection disassembly and HT™ SERIES Y-BEAM BUSHING REPLACEMENT on page 22 for bushing replacement and reassembly. SOLD OUT send a replacement, Hendrickson Suspension Bushing Tool Kit This all-new rear suspension bushing tool for Heavy Duty vehicles makes Pivot and D-pin bushing removal and installation easier tasks. With the endless and dynamic change in our industry, more complex tools are required. Hendrickson AR2 Suspension; Raydan Air Ride Suspension; Reyco Granning Air Ride Suspensions; Handling . 250"), Bushing Inside Diameter, (2. ES-90-3001G-G. ) Front axle air suspension system design specifically for bus and motorhome applications COMFORT AIR ® 15K/23K Single drive-axle rear air suspension system designed for passenger and driver comfort Only Hendrickson possess the material, manufacturing, and suspension/vehicle dynamic expertise that is demanded by global customers in every component we manufacture. Account Login; Register; 0 item(s) From Hendrickson Beam Bushings and Tandem Bolts to Hendrickson Walking Beams, Hendrickson Walking Beam Bushing Kits, Hendrickson Torque Rod Bushings And Hendrickson Saddle Assemblies. Hendrickson Truck RS 380/400/440/460 TANDEM suspension. Heavy-duty shocks incorporate rebound spring which limits rapid shock extension during Bushing Torque Rod Suits 48411-006 HAS400 Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. EB38000. Failure to maintain proper ride height settings can lead to suspension, axle or trailer damage. Contained inside the beam with sufficient compression to flex but not rotate, Hendrickson's patented Pivot bushings provide the optimum balance of ride stability, smoothness and control. Atro Engineered Systems has unveiled a Hendrickson HN Suspension Rebuild Kit. RT™/ RTE™ 34K • 40K • 46K 1 Equalizing Beam Assembly 2 See Selection Guide 45745-147 2 Cross Tube, See Selection Guide on Page 8, 1 44642-XXX RT/RTE 34K, 115/16" Diameter 44643-XXX RT/RTE 34K-46K, 27/16" Diameter 3 Rubber Center VANTRAAX ® HKANT 40K Low-maintenance slider system for dry-freight, refrigerated and specialty van trailers Home Heb1 Hendrickson Suspension Walking Beam End Ball And Socket Bushing Kit Bronze. View All Literature Pb50-26237 : lift axle bushing kit Bushing hendrickson beam kit end truckspring Hendrickson walking beam suspension bushings. For this suspension type, begin with PIVOT BUSHING INSPECTION on page 7 for pivot connection disassembly and HT™ SERIES Y-BEAM BUSHING REPLACEMENT on Bushing Tool Instructions Author: Hendrickson Trailer Commercial Vehicle Systems Subject: This quick reference guide to the removal and installation of TRI-FUNCTIONAL bushings applies to both wide and narrow bushing tools. Longitudinal torque rods engineered to optimize resistance to wind up during acceleration and braking . 321-242. 7. 24 USD Not Yet Rated Dayton Parts 321-120 Hendrickson Walking Beam End Bushing, 34K. Heavy-duty bronze ATS Offers Hendrickson OEM Replacement Parts At Discount Prices. 2. This walking beam suspension is similar in design to the Hendrickson HN suspension. Energy SKU: 90. 47 MB. hendricksonparts. Posted on August 18, Hendrickson suspension parts original replacement autoandtrucksprings center bushing service set pages 2 10 qx center and end bushing tool set for hendrickson hendrickson suspension bar pin end bushing adapter set otc spx 1749. SP-168 Parts List) 3 Rubber Center Bushing 2 See Table 1 on Page 6 29483-005L Welded End Plug 34013-097L with Loose End Plug SUSPENSION PACKAGES - Hendrickson AR2 Air Suspension Maximize Driver ComfortThe Hendrickson AR2 gives you a better ride empty and improved suspension performance by converting your RT/RTE suspension into a highly engineered and lighter weight walking beam air ride. 671"), This Hendrickson Bushing Adapter Axle and suspension site travel specifications must not be exceeded. 2800 R™/RS™/RT™ Heavy-duty SUBJECT: 650K/850K/1000K Pound Capacity Beam End Connection Tightening Torque Procedure LIT NO: 17730-149 DATE: January 2012 REVISION: D This publication for the R™/RS™-650/850/1000, RT™-650 suspensions, equipped with two/three piece adapter type or tube and nut type beam end connections, 17730-241 3 Product Description AR2™ Air Suspension Trailing arm / Saddle assembly — The heavy -duty trailing arm / saddle assembly provides lighter weight, good articulation and optimal ground clearance Large volume air springs — Rolling lobe design provides variable spring rates to deliver superior ride quality Equalizing beam — Distributes load equally noTe: The bushing replacement tool is not required for replacing the bushing assembly on an HT Y-beam suspension. Subject 2 IMPORTANT SAFETY NOTICE Proper service and repair is important to the safe and reliable Hendrickson RTE Walking Beam Hendrickson HAS Air suspension. Bar pin rubber end bushing extends service life and provides Hendrickson’s official name for the walking beam suspension is “equalizing beam”. By encasing a high-density rubber bushing inside a curled metal sleeve, Hendrickson Equalizing Beam Center Bushings. 1 Aftermarket Replacement for Hendrickson 45900 End Beam Bushing, (w/Fabricated Beam) R480/503/520/523 (w/Cast Beam) Suspension Hendrickson Rear RS Series, All Suspension Hendrickson Rear Manufacturer: Dayton Parts/Hendrickson Part Number: 321-118 Condition: New Hendrickson Walking Beam Center Bushing Capacity: 34,000 lbs Overall Length: 12" Outer Sleeve Length: 7" Outer Sleeve Diameter: 3-5/8" Inner Sleeve ID: 2" Inner Sleeve OD: 2-3/4 Includes weld-in plug for cross shaft Fits these Hendrickson Suspensions AR Outside Bushing Diameter, (4 3/8"), Outer Steel Sleeve Length, (4 250"), Overall Bushing Length, (5 . NEW2001 Western Star 4964FX double frame tri-axle dump truck, 6NZ CAT Power, 10 speed, Sirius radio. With the suspension at ride height, measure from the bottom of the beam assembly to the bottom of the frame bracket (Figure 2). Orig Hendrickson # (30437-000), Original Genuine Hendrickson Product, Center Position Walking Beam Bronze Greaseable Bushing Kit, Applications With Hendrickson Suspension R380 Thru R520 Series, Greasable Type, All Hardware Included, This Kit Replaces (2) Beams, Center Bushings Only. Amazon. Price $59. maintenance, service, repair and rebuild of the RT™ • RTE™ walking beam rear suspension systems . Smith Co. Ratings for brakes and wheel-end components differ depending upon options chosen. 7" Hendrickson Thrust Washer. , we pride ourselves on keeping your truck in good shape, putting our customers first, and giving all our clients the best service possible. Suspension ride heights must be set within Hendrickson specifications in order to provide load equalization among axles and to ensure proper suspension performance. Hendrickson Walking Beam Bushing Removal. For this suspension type, begin with PIVOT BUSHING INSPECTION on page 7 for pivot connection disassembly and HT™ SERIES Y-BEAM BUSHING REPLACEMENT on HN® Series 17730-227 3 Product Description Auxiliary springs — Engages while loaded to provide added stability when dumping or maneuvering. NOTE Use only Genuine Hendrickson parts for servicing this If HT Y-beam suspension (both welded collar and QUIK-ALIGN® style pivot connections), the entire bushing assembly gets replaced, without the need for a replacement tool. $150. Bushing, Beam End Rubber; 5 3/4"Lg. Air over walking beam suspension system . Suspension articulation may exceed vehicle’s capability and may be limited by vehicle manufacturer; vehicle manufacturer installed axle stops may restrict suspension’s articulation. Sort By: View; 12 / 24 / All; Top Pad for Hendrickson RT and RTE Walking Dayton Parts 321-118 Hendrickson Walking Beam Center Bushing, 34K. Aftermarket Replacement for Hendrickson 34013-188 Rotating Bar Pin Hendrickson puts a new twist on End Bushings! Hendrickson's continuing product development has re-defined the (w/Fabricated Beam) R480/503/520/523 (w/Cast Beam) Suspension Hendrickson Rear RS Series, All Suspension Hendrickson Rear RT/RTE, RT2/RTE2 Outside Bushing Diameter (4 3/8"), Outside Steel Sleeve Length, (3. 1Replace both bushing tube spacers and realign the axle. 1. DECRITI T . Bushings kits We have pins, U-bolts, shackle kits, shocks, hangers, bolts and bushings. You may receive a partial or no refund on used, damaged or materially different returns. 5. Uses a premium grade rubber compound formulation that Hendrickson RTE Walking Beam Torque Rods & Bushes Hendrickson’s RT and RTE series have been the Industry standard mechanical suspension for around 70 years. home. Two beams connected to each Drive axle pivot on a Walking Beams SUBJECT: Equalizing Beam Center Bushing LIT NO: SEU-0213 DATE: October 2007 REVISION: B HENDRICKSON GUIDELINES FOR REAR WALKING BEAM SUSPENSIONS EQUIPPED WITH BRONZE CENTER BUSHINGS Bronze center bushed equalizing beams are MANDATORY for the following applications: ALL walking beam Contact Hendrickson for approval of additional applications. INJURY OR PROPERTY DAMAGE. Account Login; Register; 0 item(s) Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. 3. com ARTS Equalizing Beam End Bushings Hendrickson Equalizing Beam End Bushings Engineered to maintain performance, reduce suspension wear and maximize durability. This was probably the worst set of walking beams I've ever re-bushed in my life. The truck has rte 460 suspension which is 46000 rears and mine has the Log in or Sign up. From Hendrickson Tandem Bolts to Hendrickson Walking Beams, Hendrickson Walking Beam Bushing Kits, Hendrickson Suspension Parts Are Original Replacement Suspension Parts for Hendrickson Trucks "Just ASK Bob" Hours: Mon-Fri 8:30am-5:00pm ET Sat: CLOSED Sun: CLOSED. Bar pin rubber end bushing extends service life and Hendrickson Bushing Installation Tool S-21307 OEM Hendrickson Tool The S-21307 is the Hendrickson bushing installation tool used for what is commonly called a Hendrickson "Wide Beam" suspension. From Hendrickson Tandem Bolts to Hendrickson Complete Walking Beams, Bushing Kits And Pivot bushing Bushing tube Beam assembly Figure 1: Pivot bushing components IMPORTANT: Hendrickson does not recommend disassembling the pivot connection to inspect the pivot bushing. ATS Has Access To A Large This leaf spring fits the following make/models: 1974 to 2019 Heavy Duty Trucks with Hendrickson Walking Beam w/ Leaf Spring Suspensions using 1-3/8" pins Specifications: 4" wide 10 leaves (10/. 21. If it is not a Hendrickson INTRAAX integrated suspension, then • Fewer bushings to maintain — center bushing eliminated • Rubber springs provide long service life and easy replacement • Bar pin end bushings extend service life and provide alignment capability for longer tire life • Hendrickson torque rod bushings provide longer service life than conventional bushings AR2™ Air Suspension for Manitowoc 1 Equalizing Beam Assembly 2 See Selection Guide 45745-147 2 44643-009L Cross Tube 44 7⁄ 8", (If converted from RT•RTE 1 suspension, refer to Lit. Equalizing beam design delivers long service life and 17 inches of articulation when loaded for excellent off-road mobility; Bar pin beam end connections extend bushing life and allow easy axle alignment capability for increased tire life; Hendrickson genuine torque rods enhance handling during braking and cornering Thanks For Watching!!! Please Like And Subscribe. ATRO’s new KT50-25004 includes components to do one side of the truck (two bolster springs and an auxiliary load spring). carefully guide the suspension beams and bushing tube spacers into the frame bracket (Figure 8). Prev. Cross references are not a guarantee that the part will fit any specific application. Hendrickson designs and manufactures air suspension The unique Hendrickson Bar Pin Beam End Connection can extend end bushing service life up to 50 percent with its proprietary rubber compound and design. Your Price: $573. 52K installed weight includes complete suspension, double rebound straps, longitudinal torque rods, Hendrickson TRAAX ROD™ transverse torque rods, axle brackets and frame brackets; add 31 lbs. Clair, MO 63077 Phone: (800) 325-6114 Fax: (866) 920-2005 Send Email facebook YouTube LinkedIn. SKU Heb1. The void design and material composition of our bushings are critical to controlling the horizontal, vertical and roll forces a trailer generates rolling down the road. Buy OTC Tools 4247 Hendrickson Suspension Bushing Master Tool Kit: Suspension Tools This item can be returned in its original condition for a full refund or replacement within 30 days of receipt. Part# 797-321118 . Click on the part number for pricing and information! BEAM END CONNECTIONS AND BEAM END BUSHINGS There are five types of Hendrickson Beam End connec-tions for rubber beam end bushings in suspension capacities of 34,000 through 52,000 pounds. SOLD OUT send a replacement, Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. Hendrickson’s website offers access to lift axle and bumper configurators, Parts Look Up System (PLUS+) and online educational service, repair and rebuild instructions for the AR2 suspension . 28 RF/S-20,23,25,30 Trailer Air Ride Suspension; Hendrickson: HK/HS190-230 HT190 Hendrickson Walking Beam Bushing Removal Tool. Rubber load springs, subject to chemical attack will take a compression set over time. Beam end bushings on any Hendrickson walking beam require similar maintenance. 334-109. 29878-1. This includes the traditional RT product and the Haulmaax, which incorporates a variable-rate rubber spring system. 3001G WALKING Original Hendrickson Bronze Center Walking Beam Bushing Kit. WHEN TRANSVERSE TORQUE RODS ARE USED ON WALKING BEAM New OEM Center Bushing for Hendrickson Suspension 22279L, 95620, C866. By aiding in the installation of suspension The Hendrickson HN walking beam suspension features a bar pin end bushing, and the traditional center bushing is replaced by two large bolster springs per side. Using masking tape, attach wear pads to the pivot Customer: I have a walking beam suspension on a KW truck that I have some questions about. ATRO-SK80381-+ Add to Cart . HN® Series 17730-227 3 Product Description Auxiliary springs — Engages while loaded to provide added stability when dumping or maneuvering. Conversion kit center bushing — if existing RT/RTE suspension includes bronze center bushings, they must be replaced with rubber center bushings. Hendrickson walking beam suspension bushingsBushing suspension trailer hendrickson semi replacement Hendrickson walking beam suspension bushing replacement toolHendrickson wide bushing tool. Steering Parts » Replacement Suspension Parts Incl. SP-168 Parts List) 3 Rubber Center Bushing 2 See Table 1 on Page 6 29483-005L Welded End Plug 34013-097L with Loose End Plug AR2™ Air Suspension for Manitowoc 1 Equalizing Beam Assembly 2 See Selection Guide 45745-147 2 44643-009L Cross Tube 44 7⁄ 8", (If converted from RT•RTE 1 suspension, refer to Lit. Transverse torque rods ensure maximum lateral axle control and straight line suspension stability . ) 20,000lbs Capacity SRI Certified OEM Number: 4502 Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. Replaces Hendrickson numbers 34013188, 34013-188, Tri‑FunCTional® BuSHinG replaCemenT ToolS noTe: The bushing replacement tool is not required for replacing the bushing assembly on an HT Y-beam suspension. Kit bushing beam hendrickson endHendrickson misc suspension in umatilla, or #10654 Hendrickson walking beam suspension bushingsOtc tools and equipment. Steel leaf spring rear suspension system RT™ is a durable steel spring suspension with a legacy of over 90 years of reliability in the most severe applications. Brakes, wheels and tires rated separately. D. line up the holes in the bushings with the alignment slots in the frame Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and Unlike other walking-beam suspensions, Bar pin end bushings provide rugged axle connection and extended bushing life; Hendrickson genuine torque rods help control lateral forces and optimise resistance to wind up during acceleration Otc introduces new hendrickson front suspension bushing tool set forBeam hendrickson walking bushing suspension bushings Hendrickson suspension bushing tool, no. Shopping Bag 0 item(s) Bushing, Beam End Rubber; 5 3/4"Lg. ) 35,000lbs Capacity SRI Certified These ship freig Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. L1071 - Pivot Bushing Inspection / Replacement Information Rev. Download Now From Hendrickson Tandem Bolts to Hendrickson Walking Beams, Hendrickson Walking Beam Bushing Kits, Hendrickson Load Cushion Suspension, Hendrickson Suspension Parts Are Original Replacement Suspension Parts for Hendrickson Trucks "Just ASK Bob" Hours: Mon-Fri 8:30am-5:00pm ET Sat: CLOSED Sun: CLOSED. Hendrickson Walking Beam Suspension Bushing Replacement Tool - The Best Hendrickson designs and manufactures air suspension systems and components for heavy duty trucks and trailers. Posted on August 18, L427 trailer suspension systems bushing replacement procedures hendrickson trailer tools hendrickson ultimaax vehicle specifications vehicles tech tip reduce suspension maintenance by eliminating wear ponents vehicle service pros center and end bushing Hendrickson RTE Walking Beam Hendrickson HAS Air suspension. You may also like. My Account : Home > SUSPENSION > Bushing, Beam End Rubber; - 480-523 series, 5 3/4"Lg. The Hendrickson HN walking beam suspension features a bar pin end bushing, and the traditional center bushing is replaced by two large bolster springs per side. Hendrickson specializes in designing and manufacturing a wide range of parts and products for heavy-duty trucks and trailers. Date 01/08. Date 03/22. Refer to L533 HALFTRAAX™ Axle and Beam Removal/Replacement Procedure for complete HALFTRAAX replacement Hendrickson Suspension Bushings. B. com: hendrickson bushing kit intraxx quik-align (s-24691 Kit bushing hendrickson mppartsBeam hendrickson walking bushing suspension bushings. Like the HN, the traditional center bushing is replaced by 4 Benefits: ATRO Intraax/Vantraax bushings perform better, last longer, and are backed by the industry's best warranty. Rear Suspension Conersions To learn more aout Hendrickson genuine parts call or isit endricksonpartscom GENUINE P ARTS AR2™ HAS™ COMFORT AIR® Hendrickson, the leader in suspension technology and the experts in walking beam suspensions, noTe: The bushing replacement tool is not required for replacing the bushing assembly on an HT Y-beam suspension. Hendrickson rapidly advanced this technology, providing spring designs that reduce weight by as much as 70 percent over conventional multi-leaf (flat) springs. Download Hendrickson suspension bushing replacement on semi trailer - YouTube. Replacement is recommended when the height of this spring decreases to 3 ½” or below. Heb1 Hendrickson Suspension Walking Beam End Ball And Socket Bushing Kit Bronze. End Bushings Truck End Bushings . AR2™ Rear Walking Beam Air Suspension Parts Manual If you need any assistance identifying the correct transfer case unit for your truck and equipment, contact your Hendrickson replacement part specialists at Pro Gear and Trailing Arm Bushing Service Kit, One Beam End, Includes Key Nos . By encasing a high-density rubber bushing inside a curled metal sleeve, we combine the outstanding elasticity of our proprietary rubber compound with the high tensile strength of steel. Beam End Bushing Kit For Hendrickson Rear: AR2 400/460/520, RS - (3401 SUBJECT: Equalizing Beam Center Bushing LIT NO: SEU-0213 DATE: October 2007 REVISION: B HENDRICKSON GUIDELINES FOR REAR WALKING BEAM SUSPENSIONS EQUIPPED WITH BRONZE CENTER BUSHINGS Truck Suspension Systems 800 South Frontage Road Woodridge, IL 60517-4904 USA 630. Forums. Find durable suspension parts tailored to your truck model. 5 ID. In addition, unlike other walking-beam suspensions, View and Download Chalmers Suspension International 800 Series service manual online. Description Reviews (0) Description. com: hendrickson bushing kit intraxx Axle/BeAm Weldment ReplAcement pRoceduRes Figure 8: HTRAAX in frame bracket 6. MOTORCYCLE. 375 wide x 2. Because the patented design allows the Rugged, cast aluminum saddle helps save weight. 8-1/2 inches center-to-center, 4-3/8 inch outside diameter, 1. 1 (800) 881 1843 Axle & Suspension / Hendrickson / Click on image to zoom Aftermarket Replacement for Hendrickson R-009560 Pivot Bushing Kit. 10-year/1,000,000-mile warranty on axle/beam connection; 5-year/500,000-mile structural warranty; Supported by OEMs, dealers and designated distributors nationwide; Backed by Hendrickson's outstanding technical support staff; Damaged axles can be quickly replaced, with no grinding or welding; Off-the-shelf replacement parts Hendrickson suspension bushings bushing all available parts part Torque arm bushing replaces hendrickson 57256-000 Hendrickson walking beam suspension bushing replacement tool Beam hendrickson bushing kit end bushings walking suspension truck autoandtrucksprings Suspension Parts / Suspension Bushings and Hardware / Bar Pin Bushing Kit | Hendrickson Bar Pin Bushing Kit | Hendrickson. Date 10/07. Over the past century, Hendrickson has built a strong reputation for reliable, durable products, and it is precisely this reputation that drives us to continually exceed the expectations of our customers. Refer to L427 Bushing Replacement Procedure for complete instructions. Outfit your semi truck to be Ready for the Road Ahead™ with fresh new suspension bushings, with the Hendrickson Narrow Beam Complete Bushing Installation Tool. Air springs provide long service life and easy replacement. 321-227 Bushings & Hdwe. Check all information ULTRA ROD — forged rod body with integrated forged end hub utilizing Hendrickson’s proprietary rubber bushing compound and bonded technology. BRAND NEW for trucks with Hendrickson Suspension. tnyzcuankbfxgeqtlhtrerkeqrrflsplytlwrystdgshwvnliqo